PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC02G31840.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YA
Protein Properties Length: 269aa    MW: 29309.6 Da    PI: 10.8926
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC02G31840.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA1041.3e-3296152158
        CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                      d p+YVN+KQy++Il+RRq Rakle+++kl  k+rkpylheSRh+hA++R+Rg+gGrF
  OPUNC02G31840.2  96 DGPIYVNPKQYHGILRRRQLRAKLEAQNKL-VKTRKPYLHESRHRHAMKRARGTGGRF 152
                      57****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.0E-3794155IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.73595155IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.1E-2898152IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.3E-2498120IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.3E-24129152IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MLLPSSSSSS YASKGDSRRT VDGPMRSTLT FDNNHSVVPS QNIDYGQPMA CISYPYNDSG  60
SGVWTSYSSR SVFHPQIVGG GTSPRVPLPS LEIADDGPIY VNPKQYHGIL RRRQLRAKLE  120
AQNKLVKTRK PYLHESRHRH AMKRARGTGG RFLNTKQLQL QQQSHTTSTK TTTDSQNSSG  180
SVHLRLGGGA IGDQTSFPFK AMDSQANIKR TVASASTFTV TSAAQKDDAF FDRHGHHLSS  240
FSGHFGQAGA QGGVSSMHNG TQQRVSAMR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-2098157463NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1136145RHRHAMKRAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3185740.0AK318574.1 Oryza sativa Japonica Group cDNA, clone: J090045B17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623432.11e-180PREDICTED: nuclear transcription factor Y subunit A-4 isoform X1
RefseqXP_015623433.11e-180PREDICTED: nuclear transcription factor Y subunit A-4 isoform X1
TrEMBLA0A0E0K5V10.0A0A0E0K5V1_ORYPU; Uncharacterized protein
STRINGLOC_Os02g53620.11e-179(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.12e-31nuclear factor Y, subunit A5